Trending: fictionAll contentdtubephotographylifekrsteemspanishsteemhuntactifitmindsetutopian-ioarttasteemtravelbitcoindrugwars-fightsteemmonstersbusyfooddeutschappicscryptocurrencybloghaejinsteemitcontestindiadsoundntopaznewssteempresscryptopartikoblockchainshare2steemcolorchallengegamingtripsteemsteemstemagfacademysteemsilvergoldcnmusicnextcolonyesteemtrnaturewhereinhealthmoneyocdTrendingNewHotPromotedxpilar (72)in art • 7 hours agoThe image is made of own imagination and thoughtsDigital art made by @xpilar CLIK HERE, view full size In order to use the pictures in other context…adsactly (79)in space • yesterdayADSactly Sci-Fi : Outer Earth Series 'The One Eyed Man (Part 8)'Source Hello Steemians. For those just catching up now... Are you just like me, hopelessly addicted to Sci-Fi…xpilar (72)in art • yesterdayThe image is made of own imagination and thoughtsDigital art made by @xpilar CLIK HERE, view full size In order to use the pictures in other context…adsactly (79)in fiction • 3 days agoADSactly Sci-Fi : Outer Earth Series 'The One Eyed Man (Part 7)'Source Hello Steemians. For those just catching up now... Are you just like me, hopelessly addicted to Sci-Fi…steeminganarchy (67)in fiction • 6 hours agoNovela De Ciencia Ficcion y Suspenso - "SERA" - Capitulo 32La aventura sigue..... Capitulo 32 "Hermano, siempre es bueno verte. ¿Cuál es la ocasión?" preguntó Darius…internutter (67)in fiction • yesterdaysteemCreated with Sketch.Challenge #02291-F101: Kitchen Parley"Let's see how strong this little 'rebellion' is." I walked to my son's door and knocked. "I know you don't feel like…felt.buzz (64)in dtube • 26 minutes agoFreewritehouse FreeRead: an author reading of the first seven parts of my current freewrite series "NoName"This is an author reading of the first seven parts of my current Freewrite Series “NoName". The d.tube video can be…xpilar (72)in art • 5 days agoThe image is made of own imagination and thoughtsDigital art made by @xpilar CLIK HERE, view full size In order to use the pictures in other context…tabyington (48)in fiction • 2 days agoFirstImage from Pixabay.com Anthony shut his eyes again. It’s always so bright. He knew what he was getting into, but no…steeminganarchy (67)in fiction • yesterdayNovela De Ciencia Ficcion y Suspenso - "SERA" - Capitulo 31Author rewards to be shared between @familyprotection, translator @lanzjoseg, and myself. Capitulo 31…giantbear (72)in busy • 3 days agoThe house- Chapter 21Image source Matt and Sarah did not talk about the baby again for the rest of the day. Sarah felt a lot better and…muratkbesiroglu (77)in story • 7 days agoRebellion on Titan - Part 3Part 1 Part 2 Part 3 Katerina looked more like a sorcerer than a psychiatrist with the phosphorescent…giantbear (72)in busy • yesterdayThe house- Chapter 23Image source The few days that Jack and Sarah spent together while Matt had to work, they had so much fun. The…arthur.grafo (66)in sfandf-fiction • 2 days agoLiTTLE CHERiNE Book 02 - post222I may sound like a little girl, but I really did not want to spend the night alone, just knowing he was in the house…giantbear (72)in fiction • 1 hour agoThe house- Chapter 24 - Final chapterImage source Matt arranged everything to the last detail. He kept this a secret from Sarah for the last two weeks…adsactly (79)in scifi • 6 days agoADSactly Sci-Fi : Outer Earth Series 'The One Eyed Man (Part 6)'Source Hello Steemians. For those just catching up now... Are you just like me, hopelessly addicted to Sci-Fi…ultimatewrestlin (53)in fiction • 3 days agoUltimate Online Wrestling Season 2 Ch-2: Friday Night Clash 9!2 Months Ago Over the South China Sea Private Flight - Freedom 300 from China to Washington D.C. The Ultimate…mayb (58)in writing • 4 days agosteemCreated with Sketch.We're Not Going Anywhere – Psychedelic Short StoryThis post is my contribution to the ' TrippyContest4: You moved me. ' in which you could win a lot of SMOKE. All you…giantbear (72)in busy • 2 days agoThe house- Chapter 22Image source Matt was up early the next morning and Sarah looked so peaceful he decided to let her sleep. It was the…kerrislravenhill (57)in steemsilvergold • 4 days agoAppeal of Medieval coins 3 - Claudia: Origins of the Bloody Raven – Knight in shining armorLeopold 2 Thaler by Coinshome Public Domain A lovely dream list coin from Austria dated 1626 commemorating…
