Trending: monochromeAll contentdtubelifephotographyutopian-iosteemhuntkrspanishmindsetartsteemtasteemactifittravelblogdrugwars-fightsteemmonstersbusydeutschfoodblockchainutopiancolonybitcoinappicshaejinntopazsteempressconteststeemitshare2steemdsoundagfacademyesteemtripsteemindiacryptocurrencymusicnaturepartikocnnewsfunnycryptotrfilmsteemsilvergolddrugwarssteemstemartzonesportspoetryTrendingNewHotPromotedart-universe (64)in monomad • 14 hours ago📷 MONOMAD --- Another black and white mountain shot (Tyrol/ Austria)Hello Steemians, here I want to share another nice shot from a mountain view, which I shot when I was hiking. This…art-universe (64)in monomad • yesterday📷 MONOMAD --- Another black and white mountain shot (Tyrol/ Austria)Hello Steemians, here I want to share another nice shot from a mountain view, which I shot when I was hiking. This…art-universe (64)in photography • 2 days ago📷 MONOMAD --- SLUMS IN SOWETO (Johannisburg / Africa) -- (lousy mobile shot)Hello Steemians and photography friends. This shot was taken when I was in Johannisburg in 2010. It was taken in the…art-universe (64)in art • 3 days ago📷 monomad - Amanda Sage and me - a photo from a wonderful trimester workshopHello Steemians out there. In 2017 I attended a more than wonderful 5-weeks-workshop with the breathtaking and lovely…letc (57)in photography • 23 hours agosteemCreated with Sketch.No WindowPhoto by me. Download (public domain / CC0)seckorama (65)in monochrome • 5 days agoMonochrome Sunday: MessMess, typical for spring. I have to do something about this. It's very likely followed by the cleaning... Enjoy…oleholya (52)in monomad • 2 days agoMonomad Photographic Contest: Thursday - AnimalsMonday - Macro Tuesday - Street Wednesday - Abstract Thursday - Animals Friday - Flowers Saturday - Silhouettes Sunday - Skуale.dri (41)in monomad • 10 hours agoFlowers and Friends - #monomad challenge 22 March: FlowersThis is my entry for the #monomad challenge, theme: flowers. It's Spring time so a little Hornet fulfills his…voronchihin (62)in bescouted • 3 days agoMy Tuesday entry for the #monomad challenge. ОverpassSt. Petersburg Western high-speed diameter ..... Сamera Canon PS A720ISoleholya (52)in monomad • 12 hours agoMonomad Photographic Contest: Friday - FlowersMonday - Macro Tuesday - Street Wednesday - Abstract Thursday - Animals Friday - Flowers Saturday - Silhouettes Sunday - Skуmaria444 (52)in monomad • 6 days agoMONOMAD - Wild Dry FlowersMy today's entry for #monomad photo challenge. Please do not forget to click on the photo to enlarge!)…ale.dri (41)in monomad • 3 days agoPier - #monomad challengeThis is my entry for the #monomad challenge! I took this shot in Lignano Sabbiadoro, North East of Itlay! As always…popkop (46)in monomad • 6 days agoMonomad Photographic Contest: 2019 - March 16th - Monochrome - Random frameThis is my entry for the #monomad challenge Hi, Steemians.. The usual random frame from everyday city…popkop (46)in photography • 5 days ago#photography - "Monochrome City"Hi, Steemians.. This is random photo taken last winter. It's a portrait of the city, if I may say so.…juancar347 (62)in monomad • 2 days agosteemCreated with Sketch.Monomad Challenge: cuando la Muerte es un Arte / when Death is an ArtDesde el alba de los tiempos, el hombre entendió a la Muerte desde diversos aspectos socio-culturales. Por un motivo…juancar347 (62)in monomad • 3 days agosteemCreated with Sketch.Monomad Challenge: Visiones del ayer I. La Plaza Mayor de Navalcarnero / Yesterday's visions I. The Main Square of NavalcarneroEspaña es un país de tradiciones, de alegres costumbres, que en algunas ocasiones caen en la más completa de las…ale.dri (41)in monomad • 5 days agoBlack Tree - #monomad challengeThis is my entry for the #monomad contest created by @monochromes. I took this picture with my Canon EOS 100D and…oleholya (52)in monomad • 3 days agoMonomad Photographic Contest: Tuesday - StreetMonday - Macro Tuesday - Street Wednesday - Abstract Thursday - Animals Friday - Flowers Saturday - Silhouettes Sunday - Skуoleholya (52)in monomad • 6 days agoMonomad Photographic Contest: Saturday - SilhouettesMonday - Macro Tuesday - Street Wednesday - Abstract Thursday - Animals Friday - Flowers Saturday - Silhouettes Sunday - Skуoleholya (52)in monomad • 4 days agoMonomad Photographic Contest: Monday - MacroMonday - Macro Tuesday - Street Wednesday - Abstract Thursday - Animals Friday - Flowers Saturday - Silhouettes Sunday - Skу
