New: pharmaAll contentdtubescthive-100421photographysteemappicstravelfeedtasteemzzanartactifitlifentopazsteemhuntcnspanishkrsteempresstravelbitcoinpromo-steemdeutschcreativecoinwhereinfoodsteemmonstersmusicaaasteemleosptpalnetdlikenewsbusycervantesesteemwritingcryptocurrencygodsunchainedsbdpotatosplinterlandsgamingocwednesdaywalkpoetrycurationnewsteemecotrainiosttraveldigestTrendingNewHotPromotedvijaychoure37 (21)in pharma • 17 days agosteemCreated with Sketch.Internal Tissue Sealants Industry 2019 Global Market Growth, Size, Demand, Trends, Insights and Forecast 2025Global Internal Tissue Sealants Market 2019 Industry research report is a proficient and in-depth research…sandesh.san (7)in anatomic • 26 days agoAnatomic Pathology Market : Worldwide Industry Analysis and New Opportunities ExploredAccording to the new market research report " Anatomic Pathology Market by Product & Service (Instruments (Tissue…marinatalamanou (25)in tech • last monthWhen the Pharma Giants met the Tech GiantsThe pharmaceutical industry is an example of Yin and Yang or Dark and Bright Duality. In fact, pharma is a paradox of…indigoprana (42)in vaccines • 2 months agoVaccines, no I won`t take a vaccine.This is a topic that will divide opinion, and from what I have experienced this topic can also be used as an excuse.…marinatalamanou (25)in undefined • 2 months agoFrom a demonised plant to a blossoming industryleecamp (66)in pharma • 3 months agoYou Won't Believe New Video Of Big Pharma KingpinWatch this clip from my show Redacted Tonight:leecamp (66)in pharma • 3 months agoVideo Reveals Big Pharma Villain, Bolton Gone, Israel SpyingWatch this episode of Redacted Tonight:tainagoddess (38)in pharma • 3 months agoBy: Erich AufderheideKihura Nkuba is a Ugandan public figure and radio broadcaster who traveled through towns giving lectures to people on…rosalinde (53)in cesky • 3 months agoRakovina a všetky choroby sa dajú liečiť aj bez liekovMoj brat mi poslal toto video, ktore na Youtube publikoval pan Vlado Kocian. Tento pan doktor z videa uz nema co…nathan1111 (40)in pharma • 3 months agoGoogle is Ramping Up Pharma ActivityGoogle today is not only a weapon for promoting the pharmaceutical agenda but now also a drug company itself. During…joeysievert (52)in dtube • 3 months agoEx Pharma Sales Representative Pharma Doesn't Want You To KnowTHNX FOR WATCHING ~LIKE~SHARE~SUBSCRIBE~ LINKS HELP SUPPORT MY CHANNEL ▶️ DTube ▶️ IPFSmarinatalamanou (25)in pharma • 3 months agoAI and Pharma: A modern duelmarinatalamanou (25)in pharma • 3 months agoWhen the Pharma Giants met the Tech Giantsnuovisotv (62)in threespeak • 3 months agoWir haben es satt▶️ Watch on 3Speak Video ansehen: Mit einem ohrenbetäubenden Kochtopf-Konzert forderten 33.000 Menschen bei…neuehorizontetv (67)in threespeak • 4 months agoWarum hat die Pharma Angst vor diesem Film?▶️ Watch on 3Speak Götz Wittneben im Gespräch mit dem Medizin-Journalisten Hans Tolzin zum impfkritischen Film…rosalinde (53)in cesky • 4 months agoZakazana, zatajena medicinaMnohi z vas urcite uz toto video poznaju ale su urcite i taki, pre ktorych to bude novinka, i ked je toto video z roku…nuoviso (71)in threespeak • 5 months agoHeilen ohne Medikamente - Andreas Winter bei SteinZeit▶️ Watch on 3Speak „Ich bin kein Heiler - dennoch können Menschen durch meine Arbeit gesund werden. Alles, was…ocupation (67)in conspiracy • 5 months agoPharmaceutical Scams - Patented PoisonsPharmaceutical Lobby In 2009, Lyrica - one of the members of the super-powerful and wealthy Pfizer corporation -…genexi (31)in health • 5 months agoFDA Approves Xembify for Primary ImmunodeficienciesThe US Food and Drug Administration (FDA) has approved Grifols’ first immunoglobulin Xembify®, 20% solution for the…valkyr (39)in economics • 5 months agoPrice control on drugsThe fact that this comes straight from a person in Real Estate is even more shocking. Does a plot of land in New York…
